PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G350000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 392aa    MW: 42357.3 Da    PI: 7.8486
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G350000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.67.1e-10248306563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  Sevir.9G350000.1.p 248 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 306
                         999*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16244308IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691246309IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-10248299No hitNo description
PfamPF001703.1E-9248306IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-10248305No hitNo description
CDDcd147035.47E-22249300No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MNTANGHGLM HHHHVQASMP PPPAPQHQKQ HRAGLPPTPP LPAPAGPGSH SLHHPDACMD  60
DSSAAARAQG GLPPRKAHRR SRSDVAFGYF QPPPPPKMEA GGWGLPVGAA GDDLFNAYMS  120
MEGMDGLNNS DGDSRGSSGM RTNGADSSEN ESEDYGGGGG GGADSQFLLW GDAGKKKRNA  180
AGEPAPPPPA RHARSLSMDS LMGKLSFSAN GEPGKFSLEF GGGEFTPAEM KRIMADEKLA  240
EMALADPKRV KRVLANRQSA ARSKERRMRY IAELEQKVQI LQTEATTLSA QLTLLQRDSA  300
GLATQNNELK FRLQAMEQQA QLRDALNEAL TTEVQRLKLG DTSSSSNLSQ QMQLRCQDQM  360
MEMHKQQGEQ IPFYQLEQRE QNGAPRNRDS K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352290.0BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
GenBankJX4699260.0JX469926.1 Zea mays subsp. mays clone UT3184 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.10.0PREDICTED: transcription factor RF2b-like
TrEMBLK4AKY80.0K4AKY8_SETIT; Uncharacterized protein
STRINGSi039566m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-61bZIP family protein